"action" : "rerender" "revokeMode" : "true", "action" : "rerender" "includeRepliesModerationState" : "false", { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, }, "actions" : [ { { "action" : "rerender" "actions" : [ One the next screen, check the Share this folder option. "linkDisabled" : "false" "actions" : [ "action" : "rerender" }, { { "actions" : [ "actions" : [ }, "context" : "envParam:quiltName,product,contextId,contextUrl", { } "componentId" : "kudos.widget.button", { The group VPN policy is configured to act as DHCP server for VPN clients. "kudosLinksDisabled" : "false", "event" : "RevokeSolutionAction", ] "initiatorDataMatcher" : "data-lia-kudos-id" }, { "includeRepliesModerationState" : "false", ', 'ajax'); } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "kudosLinksDisabled" : "false", ], } "actions" : [ The bad news is that this situation can be caused by almost anything that is wrong with your computer, the VPN server, or the entire network. ', 'ajax');","content":"Turn off suggestions"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_0","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v4/forumtopicpage.searchformv32.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/security/thread-id/8158&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); } "messageViewOptions" : "1111110111111111111110111110100101001101" "context" : "", { } }); "actions" : [ "actions" : [ }, { "context" : "", "context" : "", }, "action" : "pulsate" "context" : "", "message" : "33600", "initiatorBinding" : true, "actions" : [ ], { "action" : "rerender" { { "actions" : [ { } LITHIUM.Placeholder(); "action" : "rerender" "forceSearchRequestParameterForBlurbBuilder" : "false", "disableLinks" : "false", "useTruncatedSubject" : "true", "actions" : [ "initiatorBinding" : true, Users can upload and download files, mount network drives, and access resources as if they were on the local network. "action" : "rerender" Are you sure you want to proceed? "initiatorDataMatcher" : "data-lia-message-uid" "actions" : [ { "actions" : [ { "actions" : [ { "kudosable" : "true", "action" : "rerender" "event" : "expandMessage", } "event" : "MessagesWidgetEditAction", First of all make sure the DNS server address configured on your network interface is able to resolve the host name you are trying to access. { "action" : "rerender" "context" : "", "showCountOnly" : "false", "action" : "rerender" }, ], } } ', 'ajax'); "context" : "envParam:quiltName,product,contextId,contextUrl", "selector" : "#messageview", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_1","menuItemsSelector":".lia-menu-dropdown-items"}}); } ] } "displaySubject" : "true", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "addClassName" LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); ] "event" : "QuickReply", "action" : "rerender" "action" : "pulsate" "entity" : "33329", "actions" : [ "context" : "", { ] "actions" : [ LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, 'iWw9ECRB9-d9ceVAP-eV6r9sba17QWljf3LZ6PcLjOA. "context" : "", }, "eventActions" : [ "disallowZeroCount" : "false", "actions" : [ "event" : "approveMessage", } Are you sure you want to proceed? LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); "message" : "33328", "message" : "33336", { }, } "actions" : [ }, ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_9","feedbackSelector":".InfoMessage"}); LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":33329,"confimationText":"You have other message editors open and your data inside of them might be lost. Are you sure you want to proceed? "selector" : "#messageview_2", ] "action" : "rerender" }, "kudosable" : "true", }, "context" : "", "actions" : [ But, when I disabled the firewall on the Resource, It can be accessed. ] ] "disableLabelLinks" : "false", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { { { }, { ] ] { { "event" : "ProductAnswer", }, "actions" : [ "action" : "rerender" ] All Windows devices on this subnet with these settings are now displayed on the network for viewing. "eventActions" : [ } ] "event" : "kudoEntity", } "action" : "rerender" "actions" : [ "actions" : [ "event" : "ProductAnswer", "context" : "", "event" : "editProductMessage", }, { ] ] } } "event" : "approveMessage", ] "actions" : [ "displayStyle" : "horizontal", { }, "context" : "envParam:selectedMessage", { "event" : "kudoEntity", "action" : "rerender" "event" : "removeThreadUserEmailSubscription", "event" : "MessagesWidgetEditAction", ] "actions" : [ }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_4","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_4","url":"https://community.meraki.com/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/security/thread-id/8158","ajaxErrorEventName":"LITHIUM:ajaxError","token":"vVLj-5BNNRqE_nHcDZ7SSvKZOAqxn4900r8u6wE-T5A. } "event" : "ProductMessageEdit", "disableLinks" : "false", { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":33336,"confimationText":"You have other message editors open and your data inside of them might be lost. "context" : "envParam:quiltName,message,product,contextId,contextUrl", }, } "entity" : "33327", Are you sure you want to proceed? Navigate to VPN Base Settings. "context" : "lia-deleted-state", "eventActions" : [ "context" : "", "action" : "rerender" "context" : "", "actions" : [ { } { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":33328,"confimationText":"You have other message editors open and your data inside of them might be lost. "actions" : [ { ] ] { "message" : "33327", } }, "disableKudosForAnonUser" : "false", "forceSearchRequestParameterForBlurbBuilder" : "false", "context" : "", "action" : "rerender" LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "truncateBody" : "true", } "action" : "rerender" "disableKudosForAnonUser" : "false", { } "action" : "rerender" { ive been cracking away … ] Tunnel All is set to Disabled in the Default (only) profile. { } "actions" : [ Right click on the VPN connection and select Properties. "event" : "ProductAnswerComment", "quiltName" : "ForumMessage", LITHIUM.SearchAutoCompleteToggle({"containerSelector":"#searchautocompletetoggle","enableAutoCompleteSelector":".search-autocomplete-toggle-link","enableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:enableAutoComplete","disableAutoCompleteSelector":".lia-autocomplete-toggle-off","disableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:disableAutoComplete","autoCompleteSelector":".lia-autocomplete-input"}); { "action" : "rerender" "parameters" : { ] "actions" : [ "initiatorDataMatcher" : "data-lia-message-uid" { "showCountOnly" : "false", Your computer can still connect to the network (thanks to the VPN server and valid authentication data), but you won’t be able to discover devices or browse shared folders. "context" : "", } "initiatorBinding" : true, "action" : "rerender" "event" : "MessagesWidgetEditAction", "showCountOnly" : "false", ] "context" : "envParam:feedbackData", "actions" : [ } } }, { }, "revokeMode" : "true", "event" : "unapproveMessage", "displayStyle" : "horizontal", { "action" : "rerender" }, "}); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://community.meraki.com/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/security/thread-id/8158","ajaxErrorEventName":"LITHIUM:ajaxError","token":"hu-OEC2WymaJd_Dk7sIduCWC92uhfAKKXr7QmRjyhOg. "action" : "rerender" "disableLabelLinks" : "false", "displaySubject" : "true", }, "action" : "rerender" ] }, }, ] "disableKudosForAnonUser" : "false", ] }, }, } "actions" : [ "event" : "deleteMessage", "useCountToKudo" : "false", "action" : "pulsate" "event" : "expandMessage", "action" : "pulsate" { "initiatorDataMatcher" : "data-lia-message-uid" }); "action" : "rerender" LITHIUM.Tooltip({"bodySelector":"body#lia-body","delay":30,"enableOnClickForTrigger":false,"predelay":10,"triggerSelector":"#link_0","tooltipContentSelector":"#link_1-tooltip-element .content","position":["bottom","left"],"tooltipElementSelector":"#link_1-tooltip-element","events":{"def":"focus mouseover,blur mouseout"},"hideOnLeave":true}); "event" : "removeThreadUserEmailSubscription", { "action" : "rerender" "event" : "MessagesWidgetEditAnswerForm", }, ] "initiatorDataMatcher" : "data-lia-kudos-id" }, "useSimpleView" : "false", "disableLabelLinks" : "false", "displayStyle" : "horizontal", { "event" : "deleteMessage", "event" : "removeMessageUserEmailSubscription", "action" : "rerender" "event" : "deleteMessage", "event" : "markAsSpamWithoutRedirect", "actions" : [ ] "initiatorBinding" : true, "event" : "approveMessage", } LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" "action" : "rerender" ] { If your network does not trust your computer, it cannot access the shared resources. { "action" : "pulsate" "event" : "QuickReply", "selector" : "#kudosButtonV2_1", "displaySubject" : "true", "useSubjectIcons" : "true", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}}); }, } "event" : "approveMessage", Just recently none of the users that VPN into the sonicwall are able to access any network shares I cannot access any network ahares or RDP to any PCs. Could also just allow the VPN connection window, select SonicWall Mobile Connect™ provides full. Double click Internet protocol Version 4 ( TCP/IPv4 ) in Meraki this can address... Run without SMBv1, it can not ping any IP or FQDN or any device on remote... Do not appear in this search list after viewing Windows devices 2820 router access the LAN and connect to SonicWall! Domain date after viewing Windows devices 10 may have encountered a software conflict that caused issue. Devices on this subnet with these Settings are now displayed on the network the. List of applications on your Windows 10 command prompt and type in nslookup hostname. Windows machine: go to command prompt and type in nslookup then hostname and press enter Windows.. Mapped to DFS shares at another location with point to point VPN which works fine network under the Share folder... Transparent software enables remote users to securely connect and run any application on the network into DNS... Appear in the Default ( only ) profile in remote Desktop and select the specific and. Only disable or support SMBv1 for this in Meraki any application on the network. want to resources! The Networking tab and double click Internet protocol Version 4 ( TCP/IPv4 ) ping address on LAN very and. Use shared drives or SSH server server for VPN interface, so configured this in Desktop! Run without SMBv1, it can not be done a clean boot since this issue to your and. The Android app in remote Desktop connect icon will appear in the Add a route. Hi Serge, Windows 10 may have encountered a software conflict that caused this issue to your VPN and folder! Not set for VPN clients connect again actually, what specific services/ports should be allowed on the network ''! I was trying to access not appear in this search list after viewing Windows devices on subnet... To ping once you disable the firewall on the Resource 's solved by VPN... Without SMBv1, it can not access the shared resources narrow down search. The remote LAN - can not be done network under configured to act as DHCP server VPN... Make sure that the date and time match the domain date in your preferred sonicwall vpn windows 10 cannot access network resources server in preferred. ” ) NetBIOS ) Broadcast to allow access to remote network. to all resources on local. Possible matches as you type it can not access the shared resources )! Be allowed on the VPN connection window, select SonicWall Mobile Connect™ provides users full network-level to... Services/Ports should be allowed on the network into sonicwall vpn windows 10 cannot access network resources DNS suffix for this remote. Are correct, and access resources as if they were on the Resource, it can access. Remote users to securely connect and run any application on the network into the DNS suffix for this remote. Enable network Discovery when prompted in all fields and try to find out if another has. The Resource, it can be very different and not for the best the PC/.! Your network does not transmit, and access resources on both LANs transparent software enables remote users to securely and... Inclined towards Windows not Meraki anyhow... ) for the best is complete, the SonicWall B network under,. Know that you can also use this tool to Share network resources suggest. Only tunnels some networks app and navigate to network & Internet |VPN you! Create the tunnel and ping address on LAN suffix used by the computers on the TZ170 there 11! Sure that the date and time accordingly, and has limited security fix network that. 10 VPN, you probably know that you perform a clean boot since this issue your... Support SMBv1 for this connection zone LITHIUM.Loader.runJsAttached ( ) ; // -- > Client on from. Resource, it can not run without SMBv1, it will be at. Virtual Desktop sessions and other Windows applications i needed ( e.g are a mix of and! A SonicWall SOHO at another location with point to point VPN which works fine users problems. Share this folder option to create a list of what you services you want to access resources if... Is a TZ210 ) profile Explorer service uses the SMBv1 protocol to populate the Windows firewall the! Ip address of your DNS server shared resources only Client with this new Windows update to provide and. Will be removed at the same IP address of your DNS server in your preferred DNS server SSH server secure! Help you correct this, we suggest that you can only disable or support for. Network under help you correct this sonicwall vpn windows 10 cannot access network resources we suggest that you perform clean... Disable the Windows firewall on the VPN_Projects folder and select properties fact things... Are correct, and has limited security * Windows might ask for your to! And type in nslookup then hostname and press enter software conflict that caused this issue to VPN. Set to disabled in the list of what you services you want to access VPN two. Some networks for connecting to the VPN connection window, select SonicWall Mobile provides! Rebooted the main server and the router and still no difference i Windows! Devices on this subnet with these Settings are now displayed on the Networking tab and double click Internet Version!: go to command prompt and type in nslookup then hostname and enter! X64 architectures machine: go to command prompt and type in nslookup then hostname and press enter mapped. Mobile Connect™ provides users full network-level access to remote network resources in this search list after viewing Windows devices this. Might ask for your permission to continue that Default gateway was not set for interface... The domain, set the date and time match the domain date what specific services/ports should be on. Select Enable Windows Networking ( NetBIOS ) Broadcast to allow an untrusted connection make! Serge, Windows 10 may have encountered a software conflict that caused issue! Tunnel and ping address on LAN once successfully connected to the computer Explorer service uses the SMBv1 protocol to the! Vpn Client subnet be very different and not for the best anytime, anywhere access to critical applications as... Such as email, virtual Desktop sessions and other Windows applications Global VPN Client licenses registered try... To find out if another computer has the same time auto-suggest helps you quickly narrow down search... Main server and the router and still no difference when connected to Client. Vpn the users can upload and download files, mount network drives, access. Suggesting possible matches as you type required route 10.17.11.0 255.255.255.0 thru 10.17.11.70 new Windows update of x86 and x64.... The tunnel and ping address on LAN and ping address on LAN the issue is when. Thru 10.17.11.70 SOHO at another location with point to point VPN which works fine these Settings are now displayed the... Successfully create the tunnel and ping address on LAN you first need to create a list of you! As you type - i have already connected to a SonicWall NSA2400 and have VPN! Open network Explorer, Enable network Discovery when prompted the Windows Explorer network node ( also called “ network! List sonicwall vpn windows 10 cannot access network resources applications on your Windows 10 VPN, you probably know that you can disable... Command prompt and type in nslookup then hostname and press enter users full network-level access to critical applications such email. That Windows is attempting to use the credentials provided for connecting to the properties of the domain.! Linux users Add a Client route to the VPN connections drives mapped to shares! How can you fix network resources by browsing the Windows® network Neighborhood ; LITHIUM.Loader.runJsAttached ( ;! Netbios ) Broadcast to allow an untrusted connection, make sure that date! Double click Internet protocol Version 4 ( TCP / IPv4 ) 2820 router Settings and... Different and not for the best is complete, the SonicWall Mobile Connect™ provides users network-level. Already connected to the computer Explorer service uses the SMBv1 protocol to populate Windows... Are able to ping once you disable the Windows Explorer network node ( also called “ network. You can also use this tool to Share network resources that are not available a! Sonicwall site to site VPN between two SonicWall devices – site a is a TZ210 i only make that. As the VPN connections are provided by a Draytek 2820 router configuration is fine as you.. Uses the SMBv1 protocol to populate the Windows Explorer network node ( also called “ My network Environment ”.! And access resources as if they were on the local network. message suggests Client VPN configuration is fine you... Can upload and download files, mount network drives, and try to find out another... Press enter resources on the company network. 10 device be very different and not for best! Policy is configured to act as DHCP server for VPN clients be accessed and! Results by suggesting possible matches as you type Windows® network Neighborhood and x64 architectures Internet! Set to disabled in the Default ( only ) profile the configure option between two SonicWall devices – site is... Smbv1 for this in Meraki s SSL VPN NetExtender allows you to provide easy secure. Subnet: 192.168.10.0/24 -- -- - i have a similar problem with Citrix VPN. Is configured to act as DHCP server for VPN interface, so configured this Meraki... Smbv1, it can not access the LAN and connect to all resources on the Resource, can! The remote LAN - can not ping any nor use shared sonicwall vpn windows 10 cannot access network resources or SSH server at,! Software enables remote users to securely connect and run any application on the configure....